PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g051060.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 255aa    MW: 28895.9 Da    PI: 9.8076
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g051060.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.8e-3270123255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtpeLH rFv+ave+LGG+++AtPk +l++m++kgL+++hvkSHLQ+YR+
  Sopim06g051060.0.1  70 PRLRWTPELHLRFVHAVERLGGQDRATPKLVLQFMNIKGLSIAHVKSHLQMYRS 123
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-3066124IPR009057Homeodomain-like
PROSITE profilePS5129412.91766126IPR017930Myb domain
SuperFamilySSF466892.69E-1667125IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-2370125IPR006447Myb domain, plants
PfamPF002493.6E-1071122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MKGGSSSTEE DSKSNPKQQI EFEEEEDVET EVNSKAQGTT RSSSSNSTVE ENGKKPNSAS  60
VRQYVRSKTP RLRWTPELHL RFVHAVERLG GQDRATPKLV LQFMNIKGLS IAHVKSHLQM  120
YRSKKTDDPN QISTDGRFLL ENGDHHIFNL TQLSRLHGFK QTSSSSLRYD TALWNRQANS  180
LYNPYNMNIG GGSSISTRHG FASHSSHEQL FPWNKSIEIE KNQNRHNQRF WPPITQIGTS  240
SEIIRARNDD TNPC*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-155HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010322168.11e-180PREDICTED: putative two-component response regulator ARR21 isoform X2
TrEMBLK4C5P90.0K4C5P9_SOLLC; Uncharacterized protein
STRINGSolyc06g051060.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-48G2-like family protein